| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | NHP2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NHP2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NHP2. This antibody reacts with human. The NHP2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human NHP2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: IKADPDGPEAQAEACSGERTYQELLVNQNPIAQPLASRRLTRKLYKCIKKAVKQKQIRRGVKEVQKFVNKGE |
|---|
| Other Names | FLJ20479, H/ACA ribonucleoprotein complex subunit 2, NHP2 ribonucleoprotein homolog (yeast), NHP2-like protein, NHP2P, NOLA2member 2 (H/ACA small nucleolar RNPs), Nucleolar protein family A member 2, snoRNP protein NHP2 |
|---|
| Gene, Accession # | NHP2, Gene ID: 55651, Accession: Q9NX24, SwissProt: Q9NX24 |
|---|
| Catalog # | NBP2-38626 |
|---|
| Price | |
|---|
| Order / More Info | NHP2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|