| Edit |   |
|---|
| Antigenic Specificity | MICB |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MICB Antibody from Novus Biologicals is a rabbit polyclonal antibody to MICB. This antibody reacts with human. The MICB Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human MICB antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: CKKKTSAAEGPELVSLQVLDQHPVGTGDHRDAAQLGFQPLMSATGSTGSTE |
|---|
| Other Names | MHC class I chain-related protein B, MHC class I mic-B antigen, MHC class I polypeptide-related sequence B, MIC-B, PERB11.2MHC class I-like molecule PERB11.2-IMX, stress inducible class I homolog |
|---|
| Gene, Accession # | MICB, Gene ID: 4277 |
|---|
| Catalog # | NBP2-56506 |
|---|
| Price | |
|---|
| Order / More Info | MICB Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|