| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | eIF4GII |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval method is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The eIF4GII Antibody from Novus Biologicals is a rabbit polyclonal antibody to eIF4GII. This antibody reacts with human. The eIF4GII Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human eIF4GII antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: EFDSRRTLTSRGSMGREKNDKPLPSATARPNTFMRGGSSKDLLDNQSQEEQRREMLETVKQLTGGVDVERNSTEAERNKTRESAKPEISAMSA |
|---|
| Other Names | eIF-4G 3, eIF-4-gamma 3, eIF-4-gamma II, eIF4GIIeIF4G 3, eukaryotic translation initiation factor 4 gamma 3, eukaryotic translation initiation factor 4 gamma, 3 |
|---|
| Gene, Accession # | EIF4G3, Gene ID: 8672 |
|---|
| Catalog # | NBP1-84867 |
|---|
| Price | |
|---|
| Order / More Info | eIF4GII Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|