| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | EIF3J |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The EIF3J Antibody from Novus Biologicals is a rabbit polyclonal antibody to EIF3J. This antibody reacts with human. The EIF3J Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated. Specificity of human EIF3J antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: DSDSWDADAFSVEDPVRKVGGGGTAGGDRWEGEDEDED |
|---|
| Other Names | eIF3 p35, eIF3-alpha, eIF3j, eIF3-p35, EIF3S1eIF-3-alpha, Eukaryotic translation initiation factor 3 subunit 1, eukaryotic translation initiation factor 3 subunit J, eukaryotic translation initiation factor 3, subunit 1 (alpha, 35kD), eukaryotic translation initiation factor 3, subunit 1 alpha, 35kDa, eukaryotic translation initiation factor 3, subunit J |
|---|
| Gene, Accession # | EIF3J, Gene ID: 8669 |
|---|
| Catalog # | NBP2-13953 |
|---|
| Price | |
|---|
| Order / More Info | EIF3J Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|