| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | EIF3M |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The EIF3M Antibody from Novus Biologicals is a rabbit polyclonal antibody to EIF3M. This antibody reacts with human. The EIF3M Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. This product is specific to Subunit or Isoform: M |
|---|
| Immunogen | Synthetic peptides corresponding to EIF3M(eukaryotic translation initiation factor 3, subunit M) The peptide sequence was selected from the N terminal of EIF3M. Peptide sequence MSVPAFIDISEEDQAAELRAYLKSKGAEISEENSEGGLHVDLAQIIEACD. |
|---|
| Other Names | B5 receptor, dendritic cell protein, eIF3m, eukaryotic translation initiation factor 3 subunit M, eukaryotic translation initiation factor 3, subunit M, Fetal lung protein B5, FLJ29030, GA17, hfl-B5, HFLB5, PCI domain containing 1 (herpesvirus entry mediator), PCI domain-containing protein 1, PCID1B5 |
|---|
| Gene, Accession # | EIF3M, Gene ID: 10480, Accession: Q7L2H7, SwissProt: Q7L2H7 |
|---|
| Catalog # | NBP1-56654 |
|---|
| Price | |
|---|
| Order / More Info | EIF3M Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 25849773 |
|---|
| 产品资料 |
|
|