| Edit |   |
|---|
| Antigenic Specificity | Dystroglycan |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Dystroglycan Antibody from Novus Biologicals is a rabbit polyclonal antibody to Dystroglycan. This antibody reacts with mouse. The Dystroglycan Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to Dag1 (dystroglycan 1) The peptide sequence was selected from the C terminal of Dag1. Peptide sequence PPSPGSSAAPATEVPDRDPEKSSEDDVYLHTVIPAVVVAAILLIAGIIAM. |
|---|
| Other Names | A3a, AGRNR, DAG156DAG, dystroglycan, dystroglycan 1 (dystrophin-associated glycoprotein 1), Dystrophin-associated glycoprotein 1 |
|---|
| Gene, Accession # | DAG1, Gene ID: 1605, Accession: Q62165 |
|---|
| Catalog # | NBP1-69017-20ul |
|---|
| Price | |
|---|
| Order / More Info | Dystroglycan Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|