| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | dystrophia myotonica containing WD repeat motif |
|---|
| Clone | 3F5 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG1 kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The dystrophia myotonica containing WD repeat motif Antibody (3F5) from Novus Biologicals is a mouse monoclonal antibody to dystrophia myotonica containing WD repeat motif. This antibody reacts with human. The dystrophia myotonica containing WD repeat motif Antibody (3F5) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | DMWD (AAH19266 245 a.a. - 334 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GGEKPSGPVPRSRLDPAKVLGTALCPRIHEVPLLEPLVCKKIAQERLTVLLFLEDCIITACQEGLICTWARPGKAGISSQPGNSPSGTVV |
|---|
| Other Names | D19S593E, DM9, DMRN9, DMR-N9, dystrophia myotonica WD repeat-containing protein, dystrophia myotonica, WD repeat containing, dystrophia myotonica-containing WD repeat motif, Dystrophia myotonica-containing WD repeat motif protein, gene59, Protein 59, Protein DMR-N9 |
|---|
| Gene, Accession # | DMWD, Gene ID: 1762, Accession: AAH19266, SwissProt: AAH19266 |
|---|
| Catalog # | H00001762-M01 |
|---|
| Price | |
|---|
| Order / More Info | dystrophia myotonica containing WD repeat motif Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|