| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | EIF3S3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The EIF3S3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to EIF3S3. This antibody reacts with human, mouse, rat. The EIF3S3 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat EIF3S3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: QQQQKHQYQQRRQQENMQRQSRGEPPLPEEDLSKLFKPPQPPARMDSLLIAGQINTYCQNIKEFTAQNLGKLFMAQALQEYNN |
|---|
| Other Names | eIF-3-gamma, eIF3-gamma, eIF3h, eIF3-p40, EIF3S3eIF3 p40 subunit, Eukaryotic translation initiation factor 3 subunit 3, eukaryotic translation initiation factor 3 subunit H, eukaryotic translation initiation factor 3, subunit 2 (beta, 36kD), eukaryotic translation initiation factor 3, subunit 3 (gamma, 40kD), eukaryotic translation initiation factor 3, subunit 3 gamma, 40kDa, eukaryotic translation initiation factor 3, subunit H, MGC102958 |
|---|
| Gene, Accession # | EIF3H, Gene ID: 8667 |
|---|
| Catalog # | NBP1-84870 |
|---|
| Price | |
|---|
| Order / More Info | EIF3S3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|