| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ELA3A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ELA3A Antibody from Novus Biologicals is a rabbit polyclonal antibody to ELA3A. This antibody reacts with human. The ELA3A Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human ELA3A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: HTCGGSLIAPDWVVTAGHCISRDLTYQVVLGEYNLAVKEGPEQVIPINSEELFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLPPAGDIL |
|---|
| Other Names | chymotrypsin-like elastase family member 3A, chymotrypsin-like elastase family, member 3A, EC 3.4.21, EC 3.4.21.70, ELA3A, ELA3elastase 1, elastase 3A, pancreatic, elastase 3A, pancreatic (protease E), Elastase IIIA, elastase-3A, Protease E |
|---|
| Gene, Accession # | CELA3A, Gene ID: 10136 |
|---|
| Catalog # | NBP2-58716 |
|---|
| Price | |
|---|
| Order / More Info | ELA3A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|