| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ELAC1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ELAC1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ELAC1. This antibody reacts with human. The ELAC1 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human ELAC1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: IWRTMELSHTELVFHYVVHELVPTADQCPAEELKEFAHVNRADSPPKEEQGRTILLDSEENSYLLFDDEQFVVKAFRLFHRIPSFGF |
|---|
| Other Names | D29elaC (E. coli) homolog 1, Deleted in Ma29, EC 3.1.26.11, elaC homolog 1 (E. coli), ElaC homolog protein 1, FLJ59261, Ribonuclease Z 1, RNase Z 1, tRNA 3 endonuclease 1, tRNA 3' processing endoribonuclease, tRNA Z (short form), tRNase Z 1, tRNase ZS, zinc phosphodiesterase ELAC protein 1 |
|---|
| Gene, Accession # | ELAC1, Gene ID: 55520 |
|---|
| Catalog # | NBP2-57039 |
|---|
| Price | |
|---|
| Order / More Info | ELAC1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|