| Edit |   |
|---|
| Antigenic Specificity | T Plastin |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The T Plastin Antibody from Novus Biologicals is a rabbit polyclonal antibody to T Plastin. This antibody reacts with human. The T Plastin Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to PLS3(plastin 3 (T isoform)) The peptide sequence was selected from the middle region of PLS3. Peptide sequence RRYTLNVLEDLGDGQKANDDIIVNWVNRTLSEAGKSTSIQSFKDKTISSS. |
|---|
| Other Names | plastin 3, plastin 3 (T isoform), plastin-3, T plastin, T-plastinT fimbrin |
|---|
| Gene, Accession # | PLS3, Gene ID: 5358, Accession: P13797, SwissProt: P13797 |
|---|
| Catalog # | NBP1-57604 |
|---|
| Price | |
|---|
| Order / More Info | T Plastin Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|