| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Semaphorin 4D/CD100 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Semaphorin 4D/CD100 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Semaphorin 4D/CD100. This antibody reacts with human. The Semaphorin 4D/CD100 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Semaphorin 4D/CD100 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RCSVLSSAGNKTSKVQVAVMRPEVTHQERWTRELSAWRAVAGEHDRMMQSWRKAWESCSKDTL |
|---|
| Other Names | A8, CD100 antigen, CD100M-sema-G, coll-4, FLJ33485, FLJ34282, FLJ39737, FLJ46484, immunoglobulin domain (Ig), transmembrane domain (TM) and shortcytoplasmic domain, 4D, MGC169138, MGC169141, sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and shortcytoplasmic domain, (semaphorin) 4D, semaphorin-4D |
|---|
| Gene, Accession # | SEMA4D, Gene ID: 10507 |
|---|
| Catalog # | NBP1-86704 |
|---|
| Price | |
|---|
| Order / More Info | Semaphorin 4D/CD100 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|