| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Semaphorin 4F |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Semaphorin 4F Antibody from Novus Biologicals is a rabbit polyclonal antibody to Semaphorin 4F. This antibody reacts with human. The Semaphorin 4F Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human Semaphorin 4F antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RTSLPISEADSCLTRFAVPHTYNYSVLLVDPASHTLYVGARDTIFALSLPFSGERPRRIDWMVPEAHRQNCRKKGKKEDECHNFVQIL |
|---|
| Other Names | M-SEMA, m-Sema-M, PRO2353, sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and shortcytoplasmic domain, (semaphorin) 4F, sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and shortcytoplasmic domain, 4F, Sema M, Sema W, SEMAM, semaphorin-4F, semaphorin-M, Semaphorin-W, SEMAWsemaphorin M |
|---|
| Gene, Accession # | SEMA4F, Gene ID: 10505 |
|---|
| Catalog # | NBP2-57426 |
|---|
| Price | |
|---|
| Order / More Info | Semaphorin 4F Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|