| 产品详情 |
| Edit |   |
| Antigenic Specificity | CD40 Ligand/TNFSF5 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified, no preservative |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CD40 Ligand/TNFSF5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CD40 Ligand/TNFSF5. This antibody reacts with human. The CD40 Ligand/TNFSF5 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
| Immunogen | Synthetic peptides corresponding to CD40LG(CD40 ligand (TNF superfamily, member 5, hyper-IgM syndrome)) The peptide sequence was selected from the middle region of CD40LG. Peptide sequence ENSFEMQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLEN |
| Other Names | CD154, CD154 antigen, CD40 antigen ligand, CD40 ligand, CD40-L, CD40LIGM, gp39, hCD40L, HIGM1, T-B cell-activating molecule, T-BAM, T-cell antigen Gp39, TNF-related activation protein, TNFSF5IMD3, TRAPtumor necrosis factor (ligand) superfamily, member 5 (hyper-IgM syndrome), tumor necrosis factor (ligand) superfamily member 5, Tumor necrosis factor ligand superfamily member 5 |
| Gene, Accession # | CD40LG, Gene ID: 959, Accession: P29965, SwissProt: P29965 |
| Catalog # | NBP1-59186 |
| Price | |
| Order / More Info | CD40 Ligand/TNFSF5 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|