| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | RTCD1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat, Drosophila |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. IHC, WB reported in scientific literature (PMID: 25961792). For IHC-Paraffin, HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RTCD1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RTCD1. This antibody reacts with human, mouse, rat, drosophila. The RTCD1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of RTCD1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LFAASPSELHLKGGTNAEMAPQIDYTVMVFKPIVEKFGFIFNCDIKTRGYYPKGGGEVIVRMSPVKQLNPINLTERGCVTKIY |
|---|
| Other Names | phosphate cyclase, RNA 3'-terminal phosphate cyclase, RNA cyclase, RNA terminal phosphate cyclase domain 1, RNA terminal phosphate cyclase domain-containing protein 1, RNA-3'-phosphate cyclase, RPC1, RPCEC 6.5.1.4, RTC domain containing 1, RTC domain-containing protein 1, RTC1 |
|---|
| Gene, Accession # | RTCA, Gene ID: 8634 |
|---|
| Catalog # | NBP1-87113 |
|---|
| Price | |
|---|
| Order / More Info | RTCD1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 25961792 |
|---|
| 产品资料 |
|
|