| Edit |   |
|---|
| Antigenic Specificity | RTDR1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RTDR1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RTDR1. This antibody reacts with human. The RTDR1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to RTDR1(rhabdoid tumor deletion region gene 1) The peptide sequence was selected from the N terminal of RTDR1. Peptide sequence MAHSQNSLELPININATQITTAYGHRALPKLKEELQSEDLQTRQKALMAL. |
|---|
| Other Names | MGC16968, rhabdoid tumor deletion region gene 1, rhabdoid tumor deletion region protein 1 |
|---|
| Gene, Accession # | RTDR1, Gene ID: 27156, Accession: Q9UHP6, SwissProt: Q9UHP6 |
|---|
| Catalog # | NBP1-56493-20ul |
|---|
| Price | |
|---|
| Order / More Info | RTDR1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|