| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MASL1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MASL1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MASL1. This antibody reacts with human. The MASL1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human MASL1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: PGLHYTVHILCSKCLKRGSPNPHAFPGELLSQPRPEGVAEIICPKNGSERVNVALVYPPTPTVISPCSKKNVGEKHR |
|---|
| Other Names | Leucine Rich Repeat Containing 65, LRRC65, Malignant Fibrous Histiocytoma Amplified Sequence 1, Malignant Fibrous Histiocytoma-Amplified Sequence 1, Malignant Fibrous Histiocytoma-Amplified Sequence With Leucine-Rich Tandem, MFH-Amplified Sequences With Leucine-Rich Tandem Repeats 1, MFHAS1 |
|---|
| Gene, Accession # | MFHAS1, Gene ID: 9258, Accession: Q9Y4C4, SwissProt: Q9Y4C4 |
|---|
| Catalog # | NBP2-30382 |
|---|
| Price | |
|---|
| Order / More Info | MASL1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|