| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MAST1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MAST1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MAST1. This antibody reacts with human. The MAST1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LTLREKTWRGGSPEIKRFSASEASFLEGEASPPLGARRRFSALLEPSRFSAPQEDEDE |
|---|
| Other Names | EC 2.7.11, EC 2.7.11.1, KIAA0973microtubule-associated serine/threonine-protein kinase 1, microtubule associated serine/threonine kinase 1, SAST170, SASTsyntrophin associated serine/threonine kinase, Syntrophin-associated serine/threonine-protein kinase |
|---|
| Gene, Accession # | MAST1, Gene ID: 22983 |
|---|
| Catalog # | NBP2-62681 |
|---|
| Price | |
|---|
| Order / More Info | MAST1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|