| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MASP2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MASP2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MASP2. This antibody reacts with human. The MASP2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence. |
|---|
| Immunogen | Synthetic peptides corresponding to MASP2(mannan-binding lectin serine peptidase 2) The peptide sequence was selected from the N terminal of MASP2. Peptide sequence FPGEYANDQERRWTLTAPPGYRLRLYFTHFDLELSHLCEYDFVKLSSGAK. |
|---|
| Other Names | EC 3.4.21, EC 3.4.21.104, mannan-binding lectin serine peptidase 1 pseudogene 1, mannan-binding lectin serine peptidase 2, mannan-binding lectin serine protease 1 pseudogene 1, mannan-binding lectin serine protease 2, Mannose-binding protein-associated serine protease 2, MAP19, MASP1P1, MASP-2, MBL-associated plasma protein of 19 kD, MBL-associated serine protease 2, small MBL-associated protein, sMAP |
|---|
| Gene, Accession # | MASP2, Gene ID: 10747, Accession: O00187, SwissProt: O00187 |
|---|
| Catalog # | NBP1-58986 |
|---|
| Price | |
|---|
| Order / More Info | MASP2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|