| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MAST205 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. WB reported in scientific literature (PMID: 23717670). For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MAST205 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MAST205. This antibody reacts with human. The MAST205 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human MAST205 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LLFRKLSNPDIFSSTGKVKLQRQLSQDDCKLWRGNLASSLSGKQLLPLSSSVHSSVGQVTWQSSGEASNLVRMRNQS |
|---|
| Other Names | EC 2.7.11, EC 2.7.11.1, FLJ39200, KIAA0807RP4-533D7.1, MAST205microtubule associated testis specific serine/threonine protein kinase, microtubule associated serine/threonine kinase 2, microtubule-associated serine/threonine-protein kinase 2, MTSSK |
|---|
| Gene, Accession # | MAST2, Gene ID: 23139 |
|---|
| Catalog # | NBP1-87899 |
|---|
| Price | |
|---|
| Order / More Info | MAST205 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 23717670 |
|---|
| 产品资料 |
|
|