| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | n-Myc |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The n-Myc Antibody from Novus Biologicals is a rabbit polyclonal antibody to n-Myc. This antibody reacts with human. The n-Myc Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human n-Myc antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VEKRRSSSNTKAVTTFTITVRPKNAALGPGRAQSSELILKRCLPIHQQHNYAA |
|---|
| Other Names | BHLHE37, bHLHe37N-myc proto-oncogene protein, Class E basic helix-loop-helix protein 37, MODED, neuroblastoma-derived v-myc avian myelocytomatosis viral related oncogene, N-myc, NMYCneuroblastoma MYC oncogene, ODED, oncogene NMYC, pp65/67, v-myc avian myelocytomatosis viral related oncogene, neuroblastoma derived, v-myc myelocytomatosis viral related oncogene, neuroblastoma derived (avian) |
|---|
| Gene, Accession # | MYCN, Gene ID: 4613 |
|---|
| Catalog # | NBP2-56178 |
|---|
| Price | |
|---|
| Order / More Info | n-Myc Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|