| Edit |   |
|---|
| Antigenic Specificity | RUSC1 antisense RNA 1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RUSC1 antisense RNA 1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RUSC1 antisense RNA 1. This antibody reacts with human. The RUSC1 antisense RNA 1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to RUSC1 antisense RNA 1 The peptide sequence was selected from the middle region of RUSC1 antisense RNA 1 (50ug). Peptide sequence APLSCPAPRAQVHRSTPMGRALLTRVLLEPLRPWACPRLPRSPPGGAQSG. |
|---|
| Other Names | chromosome 1 open reading frame 104, FLJ35976, hypothetical protein LOC284618, RP11-21N7.3 |
|---|
| Gene, Accession # | RUSC1-AS1, Gene ID: 284618, Accession: Q66K80, SwissProt: Q66K80 |
|---|
| Catalog # | NBP1-57729-20ul |
|---|
| Price | |
|---|
| Order / More Info | RUSC1 antisense RNA 1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|