| 产品详情 |
| Edit |   |
| Antigenic Specificity | Thromboxane synthase |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Thromboxane synthase Antibody from Novus Biologicals is a rabbit polyclonal antibody to Thromboxane synthase. This antibody reacts with human, rat. The Thromboxane synthase Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Thromboxane synthase antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: RGALMSAFSPEKLNEMVPLISQACDLLLAHLKRYAESGDAFDIQRCYCNYTTDVVASVAFGTPVDSWQAPEDPFVKHCKRFFEFCIP |
| Other Names | CYP5A1family 5, subfamily A, polypeptide 1, CYP5FLJ52771, EC 5.3.99.5, GHOSAL, platelet, cytochrome P450, subfamily V, thromboxane A synthase 1 (platelet), thromboxane A synthase 1 (platelet, cytochrome P450, family 5, subfamily A), thromboxane A synthase 1 (platelet, cytochrome P450, subfamily V), thromboxane-A synthase, TXA synthase |
| Gene, Accession # | TBXAS1, Gene ID: 6916, Accession: P24557, SwissProt: P24557 |
| Catalog # | NBP2-33946 |
| Price | |
| Order / More Info | Thromboxane synthase Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 26211743 |
| 产品资料 |
|
|