| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | HOXD4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The HOXD4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to HOXD4. This antibody reacts with human. The HOXD4 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human HOXD4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: ARAYSQSDPKQPPSGTALKQPAVVYPWMKKV |
|---|
| Other Names | HHO.C13, homeo box D4, homeobox D4, Homeobox protein HHO.C13, Homeobox protein Hox-4B, Homeobox protein Hox-5.1, homeobox protein Hox-D4, HOX4, Hox-4.2, Hox-4.2, mouse, homolog of homeo box X, HOX4BHOX-5.1 |
|---|
| Gene, Accession # | HOXD4, Gene ID: 3233 |
|---|
| Catalog # | NBP2-49631 |
|---|
| Price | |
|---|
| Order / More Info | HOXD4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|