| 产品详情 |
| Edit |   |
| Antigenic Specificity | GPRC5A/RAI3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry Free-Floating. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. IHC reported in the literature. The G Protein-Coupled Receptor RAI3 Is an Independent Prognostic Factor for Pancreatic Cancer Survival and Regulates Proliferation via STAT3 Phosphorylation |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The GPRC5A/RAI3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to GPRC5A/RAI3. This antibody reacts with human. The GPRC5A/RAI3 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry Free-Floating. Specificity of human GPRC5A/RAI3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LTKQRNPMDYPVEDAFCKPQLVKKSYGVENRAYSQEEITQGFEETGDTLYAPYSTHFQLQNQPPQKEFSIPR |
| Other Names | G protein-coupled receptor, family C, group 5, member A, GPCR5A, Orphan G-protein-coupling receptor PEIG-1, RAI3G-protein coupled receptor family C group 5 member A, RAIG1RAIG-1, retinoic acid induced 3, retinoic acid responsive, Retinoic acid-induced gene 1 protein, retinoic acid-induced protein 3 |
| Gene, Accession # | GPRC5A, Gene ID: 9052 |
| Catalog # | NBP1-89743 |
| Price | |
| Order / More Info | GPRC5A/RAI3 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 28114355, 29949874 |
| 产品资料 |
|
|