| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | GPRC5C |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For Immunohistochemistry-Paraffin, HIER pH6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The GPRC5C Antibody from Novus Biologicals is a rabbit polyclonal antibody to GPRC5C. This antibody reacts with human. The GPRC5C Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human GPRC5C antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TSVYQPTEMALMHKVPSEGAYDIILPRATANSQVMGSANSTLRAEDMYSAQSHQAATPPKDGKNSQVFRN |
|---|
| Other Names | G protein-coupled receptor, family C, group 5, member C, MGC131820, RAIG-3G-protein coupled receptor family C group 5 member C, RAIG3orphan G-protein coupled receptor, retinoic acid responsive gene protein, Retinoic acid-induced gene 3 protein |
|---|
| Gene, Accession # | GPRC5C, Gene ID: 55890, Accession: Q9NQ84, SwissProt: Q9NQ84 |
|---|
| Catalog # | NBP1-87159 |
|---|
| Price | |
|---|
| Order / More Info | GPRC5C Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|