| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Frizzled-4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Frizzled-4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Frizzled-4. This antibody reacts with human. The Frizzled-4 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human Frizzled-4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PVLKEFGFAWPESLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQPGEECHSVGTNSDQYIWVKRSLNCVLKCGYDAGLYSRSA |
|---|
| Other Names | CD344, CD344 antigen, EVR1, exudative vitreoretinopathy 1, FEVR, frizzled (Drosophila) homolog 4, frizzled homolog 4 (Drosophila), frizzled-4, Fz-4, FZD4S, FzE4, GPCR, hFz4, MGC34390, WNT receptor frizzled-4 |
|---|
| Gene, Accession # | FZD4, Gene ID: 8322 |
|---|
| Catalog # | NBP2-57807 |
|---|
| Price | |
|---|
| Order / More Info | Frizzled-4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|