| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Frizzled-5 |
|---|
| Clone | 6A3 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunoprecipitation, Proximity Ligation Assay. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Frizzled-5 Antibody (6A3) from Novus Biologicals is a mouse monoclonal antibody to Frizzled-5. This antibody reacts with human. The Frizzled-5 Antibody (6A3) has been validated for the following applications: Western Blot, ELISA, Immunoprecipitation, Proximity Ligation Assay. |
|---|
| Immunogen | FZD5 (ENSP00000354607 72 a.a. - 161 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PLVEIQCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLMRQYGFAWPERMSCDRLPVLGRDAEVLCMDYNRSEATTAPPR |
|---|
| Other Names | C2orf31, chromosome 2 open reading frame 31, DKFZP434E2135, frizzled (Drosophila) homolog 5, frizzled homolog 5 (Drosophila), frizzled-5, Fz-5, FzE5, HFZ5, MGC129692, seven-transmembrane receptor frizzled-5, Wnt receptor |
|---|
| Gene, Accession # | FZD5, Gene ID: 7855, Accession: NP_003459, SwissProt: NP_003459 |
|---|
| Catalog # | H00007855-M01 |
|---|
| Price | |
|---|
| Order / More Info | Frizzled-5 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 28840375 |
|---|
| 产品资料 |
|
|