| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ICA1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ICA1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ICA1. This antibody reacts with human. The ICA1 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human ICA1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: HESFKGYQPYEFTTLKSLQDPMKKLVEKEEKKKINQQESTDAAVQEPSQLISLEEENQRKESSSFK |
|---|
| Other Names | diabetes mellitus type I autoantigen, ICA69, ICAp69Islet cell autoantigen p69,69 kDa islet cell autoantigen, islet cell autoantigen 1, islet cell autoantigen 1 (69kD), islet cell autoantigen 1 isoform, islet cell autoantigen 1, 69kDa, p69 |
|---|
| Gene, Accession # | ICA1, Gene ID: 3382 |
|---|
| Catalog # | NBP2-56868 |
|---|
| Price | |
|---|
| Order / More Info | ICA1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|