| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CSE1L/CAS/Exportin-2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CSE1L/CAS/Exportin-2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CSE1L/CAS/Exportin-2. This antibody reacts with human. The CSE1L/CAS/Exportin-2 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human CSE1L/CAS/Exportin-2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: HGITQANELVNLTEFFVNHILPDLKSANVNEFPVLKADGIKYIMIFRNQVPKEHLLVSIPLLINHLQAESIVVHTYAAHALERLFTMRGPNNATLF |
|---|
| Other Names | CASMGC117283, Cellular apoptosis susceptibility protein, chromosome segregation 1 (yeast homolog)-like, Chromosome segregation 1-like protein, CSE1, CSE1 chromosome segregation 1-like (yeast), CSE1L, Exp2, exportin-2, Importin-alpha re-exporter, MGC130037, XPO2MGC130036 |
|---|
| Gene, Accession # | CSE1L, Gene ID: 1434, Accession: P55060, SwissProt: P55060 |
|---|
| Catalog # | NBP2-38384 |
|---|
| Price | |
|---|
| Order / More Info | CSE1L/CAS/Exportin-2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|