| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PREX2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PREX2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PREX2. This antibody reacts with human. The PREX2 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human PREX2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ('HRLMKHDLKVVENVIAKSLLIKSNEGSYGFGLEDKNKVPIIKLVEKGSNAEMAGMEVGKKIFAINGDLVFMRPFNEVDCFLKSCLNSRKPLRVLVSTKP',) |
|---|
| Other Names | DEP domain-containing protein 2, DEP.2, DEPDC2, phosphatidylinositol 34,5-trisphosphate-dependent Rac exchanger 2 protein, phosphatidylinositol-34,5-trisphosphate-dependent Rac exchange factor 2, P-REX2,6230420N16Rik, PtdIns(34,5)-dependent Rac exchanger 2 |
|---|
| Gene, Accession # | PREX2, Gene ID: 80243 |
|---|
| Catalog # | NBP2-56590 |
|---|
| Price | |
|---|
| Order / More Info | PREX2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|