| 产品详情 |
| Edit |   |
| Antigenic Specificity | PRG2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The PRG2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PRG2. This antibody reacts with human. The PRG2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human PRG2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GSGSEDASKKDGAVESISVPDMVDKNLTCPEEEDTVKVVGIPGCQTCRYLLVRSLQTFSQAWFTCRRC |
| Other Names | BMPGeosinophil major basic protein, bone marrow proteoglycan, bone-marrow proteoglycan, MBP1, MBPeosinophil granule major basic protein, MGC14537, natural killer cell activator, Proteoglycan 2, proteoglycan 2 preproprotein, proteoglycan 2, bone marrow (natural killer cell activator, eosinophil granulemajor basic protein) |
| Gene, Accession # | PRG2, Gene ID: 5553, Accession: P13727, SwissProt: P13727 |
| Catalog # | NBP1-88573 |
| Price | |
| Order / More Info | PRG2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 28347715 |
| 产品资料 |
|
|