| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Sigma-1 R/OPRS1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Sigma-1 R/OPRS1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Sigma-1 R/OPRS1. This antibody reacts with human. The Sigma-1 R/OPRS1 Antibody has been validated for the following applications: Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Sigma-1 R/OPRS1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGG |
|---|
| Other Names | Aging-associated gene 8 protein, FLJ25585, hSigmaR1, OPRS1, SIG-1R, sigma 1, Sigma 1-type opioid receptor, sigma non-opioid intracellular receptor 1, sigma1 receptor, sigma1R, sigma1-receptor, SR31747 binding protein 1, SR31747-binding protein, SR-BP, SR-BP1, SRBPMGC3851, type I sigma receptor |
|---|
| Gene, Accession # | SIGMAR1, Gene ID: 10280 |
|---|
| Catalog # | NBP1-82479 |
|---|
| Price | |
|---|
| Order / More Info | Sigma-1 R/OPRS1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 23187127, 24634165 |
|---|
| 产品资料 |
|
|