| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Signal Peptide Peptidase |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Signal Peptide Peptidase Antibody from Novus Biologicals is a rabbit polyclonal antibody to Signal Peptide Peptidase. This antibody reacts with human. The Signal Peptide Peptidase Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human Signal Peptide Peptidase antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KGEVTEMFSYEESNPKDPAAVTESKEGTEASASKGLEKKEK |
|---|
| Other Names | dJ324O17.1, EC 3.4.23.-, H13hIMP1, histocompatibility (minor) 13, IMP-1, IMP1MSTP086, Intramembrane protease 1, minor histocompatibility antigen 13, minor histocompatibility antigen H13, Presenilin-like protein 3, PSENL3, PSL3IMPAS, Signal peptide peptidase, signal peptide peptidase beta, SPPIMPAS-1 |
|---|
| Gene, Accession # | HM13, Gene ID: 81502 |
|---|
| Catalog # | NBP2-54935 |
|---|
| Price | |
|---|
| Order / More Info | Signal Peptide Peptidase Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|