| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Signal peptide peptidase-like 2B |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Signal peptide peptidase-like 2B Antibody from Novus Biologicals is a rabbit polyclonal antibody to Signal peptide peptidase-like 2B. This antibody reacts with human. The Signal peptide peptidase-like 2B Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human Signal peptide peptidase-like 2B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: YWAGSRDVKKRYMKHKRDDGPEKQEDEAVDV |
|---|
| Other Names | EC 3.4.23, EC 3.4.23.-, IMP-4, IMP4MGC111084, Intramembrane protease 4, KIAA1532signal peptide peptidase-like 2B, Presenilin-like protein 1, PSL1, SNPPL2B, SPPL2b, SPP-like 2B |
|---|
| Gene, Accession # | SPPL2B, Gene ID: 56928 |
|---|
| Catalog # | NBP2-55073 |
|---|
| Price | |
|---|
| Order / More Info | Signal peptide peptidase-like 2B Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|