| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | WAC |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The WAC Antibody from Novus Biologicals is a rabbit polyclonal antibody to WAC. This antibody reacts with human. The WAC Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human WAC antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RLSDGCHDRRGDSQPYQALKYSSKSHPSSGDHRHEKMRDAGDPSPPNKMLRRSDSPENKYSDSTGHSKAKNVHTHRVRERDGGTSYSPQENSH |
|---|
| Other Names | 1110067P07Rik, bA48B24, bA48B24.1, BM-016, FLJ31290, KIAA1844, MGC10753, PRO1741, WW domain containing adaptor with coiled-coil, WW domain-containing adapter protein with coiled-coil, WW domain-containing adaptor with coiled coil, Wwp4 |
|---|
| Gene, Accession # | WAC, Gene ID: 51322, Accession: Q9BTA9, SwissProt: Q9BTA9 |
|---|
| Catalog # | NBP1-88581 |
|---|
| Price | |
|---|
| Order / More Info | WAC Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|