| Edit |   |
|---|
| Antigenic Specificity | WAPL |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The WAPL Antibody from Novus Biologicals is a rabbit polyclonal antibody to WAPL. This antibody reacts with human. The WAPL Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human WAPL antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: IVTALKCRREDKELYTVVQHVKHFNDVVEFGENQEFTDDIEYLLSGLKSTQPLNTRCLSVISLATKCAMPSFRMHLR |
|---|
| Other Names | FOEKIAA0261friend of EBNA2 (Epstein-Barr virus nuclear protein 2), Friend of EBNA2 protein, WAPLwings apart-like protein homolog, wings apart-like homolog (Drosophila) |
|---|
| Gene, Accession # | WAPAL, Gene ID: 23063 |
|---|
| Catalog # | NBP1-92578 |
|---|
| Price | |
|---|
| Order / More Info | WAPL Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|