| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | WASF2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The WASF2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to WASF2. This antibody reacts with human. The WASF2 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human WASF2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: DSASSPSPSFSEDNLPPPPAEFSYPVDNQRGSGLAGPKRSSVVSPSHPPPAP |
|---|
| Other Names | IMD2, Protein WAVE-2, SCAR2suppressor of cyclic-AMP receptor (WASP-family), Verprolin homology domain-containing protein 2, WAS protein family, member 2, WASP family Verprolin-homologous protein 2, WAVE2dJ393P12.2, wiskWASP family protein member 2 |
|---|
| Gene, Accession # | WASF2, Gene ID: 10163, Accession: Q9Y6W5, SwissProt: Q9Y6W5 |
|---|
| Catalog # | NBP2-37912 |
|---|
| Price | |
|---|
| Order / More Info | WASF2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|