| 产品详情 |
| Edit |   |
| Antigenic Specificity | Prion protein |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Prion protein Antibody from Novus Biologicals is a rabbit polyclonal antibody to Prion protein. This antibody reacts with human. The Prion protein Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Prion protein antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GSPGGNRYPPQGGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQGGGTHSQWNKPSKP |
| Other Names | CD230, CJD, fatal familial insomnia), GSS, prion protein, prion protein (p27-30), prion protein PrP, prion-related protein, PRIPMGC26679 |
| Gene, Accession # | PRNP, Gene ID: 5621, Accession: P04156, SwissProt: P04156 |
| Catalog # | NBP2-38508 |
| Price | |
| Order / More Info | Prion protein Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|