| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ZER1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ZER1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZER1. This antibody reacts with human. The ZER1 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LFYLTNSEYRSEQSVKLRRQVIQVVLNGMESYQEVTVQRNCCLTLCNFSIPEELEFQYRRVNELLLSILNPTRQDESIQRIAVHLCNALVC |
|---|
| Other Names | C9orf60, chromosome 9 open reading frame 60, homolog of Zyg-11, Hzygzyg-11 homolog B (C. elegans)-like, protein zer-1 homolog, zer-1 homolog (C. elegans), ZYG homolog, Zyg-11 homolog B-like protein, ZYG11BL, ZYGRP11-545E17.4 |
|---|
| Gene, Accession # | ZER1, Gene ID: 10444, Accession: Q7Z7L7, SwissProt: Q7Z7L7 |
|---|
| Catalog # | NBP2-33525 |
|---|
| Price | |
|---|
| Order / More Info | ZER1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|