| Edit |   |
|---|
| Antigenic Specificity | ZFAND3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ZFAND3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZFAND3. This antibody reacts with human. The ZFAND3 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human ZFAND3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MGDAGSERSKAPSLPPRCPCGFWGSSKTMNLCSKCFADFQKKQPDDDSAPSTSNSQSDLFSEETTSDNNNTSITTPTLSP |
|---|
| Other Names | AN1-type zinc finger protein 3, FLJ17799, testis expressed sequence 27, Testis-expressed sequence 27, TEX27FLJ13222, zinc finger, AN1-type domain 3 |
|---|
| Gene, Accession # | ZFAND3, Gene ID: 60685 |
|---|
| Catalog # | NBP1-82262 |
|---|
| Price | |
|---|
| Order / More Info | ZFAND3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|