| 产品详情 |
| Edit |   |
| Antigenic Specificity | PPIL3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The PPIL3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PPIL3. This antibody reacts with human, mouse, rat. The PPIL3 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat PPIL3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GSQFFITYGKQPHLDMKYTVFGKVIDGLETLDELEKLPVNEKTYRPLNDV HIKDITIHANP |
| Other Names | Cyclophilin J, cyclophilin-like protein 3, Cyclophilin-like protein PPIL3, CyPJ, EC 5.2.1.8, peptidyl-prolyl cis-trans isomerase-like 3, peptidylprolyl cis-trans isomerase-like protein 3, peptidylprolyl isomerase (cyclophilin)-like 3, PPIase, PPIase-like protein 3, Rotamase PPIL3 |
| Gene, Accession # | PPIL3, Gene ID: 53938 |
| Catalog # | NBP2-13794 |
| Price | |
| Order / More Info | PPIL3 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|