| 产品详情 |
| Edit |   |
| Antigenic Specificity | Carboxylesterase 1/CES1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Carboxylesterase 1/CES1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Carboxylesterase 1/CES1. This antibody reacts with human. The Carboxylesterase 1/CES1 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human CES1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: HWPEYNQKEGYLQIGANTQAAQKLKDKEVAFWTNLFAKKAVEKPPQTEHIEL |
| Other Names | ACAT, acyl coenzyme A:cholesterol acyltransferase, Acyl-coenzyme A:cholesterol acyltransferase, Brain carboxylesterase hBr1, carboxylesterase 1, carboxylesterase 1 (monocyte/macrophage serine esterase 1), carboxylesterase 2 (liver), CEH, Ces-1, CES1A2, CES2EC 3.1.1.1, cholesteryl ester hydrolase, Cocaine carboxylesterase, EC 3.1.1, egasyn, HMSE1, HMSECES1A1, human monocyte/macrophage serine esterase 1, liver carboxylesterase 1, MGC117365, Monocyte/macrophage serine esterase, PCE-1, REH, Retinyl ester hydrolase, Serine esterase 1, Ses-1, SES1TGH, Triacylglycerol hydrolase |
| Gene, Accession # | CES1, Gene ID: 1066 |
| Catalog # | NBP2-48854 |
| Price | |
| Order / More Info | Carboxylesterase 1/CES1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|