| Edit |   |
| Antigenic Specificity | Carboxylesterase 3/CES3/Esterase 31 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Carboxylesterase 3/CES3/Esterase 31 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Carboxylesterase 3/CES3/Esterase 31. This antibody reacts with human. The Carboxylesterase 3/CES3/Esterase 31 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Carboxylesterase 3/CES3/Esterase 31 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: PVLTSLDVPPEMMPTVIDEYLGSNSDAQAKCQAFQEFMGDVFINVPTVSFSRYLRDSGSPVFFYEFQHRPSSF |
| Other Names | carboxylesterase 3, carboxylesterase 3 (brain), EC 3.1.1, EC 3.1.1.1, ES31FLJ21736, esterase 31, Liver carboxylesterase 31 homolog |
| Gene, Accession # | CES3, Gene ID: 23491 |
| Catalog # | NBP2-48728 |
| Price | |
| Order / More Info | Carboxylesterase 3/CES3/Esterase 31 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |