| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Carboxyl Ester Lipase/CEL |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Carboxyl Ester Lipase/CEL Antibody from Novus Biologicals is a rabbit polyclonal antibody to Carboxyl Ester Lipase/CEL. This antibody reacts with human. The Carboxyl Ester Lipase/CEL Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Carboxyl Ester Lipase/CEL antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: HWEPYTTENSGYLEITKKMGSSSMKRSLRTNFLRYWTLTYLALPTVTDQEATPVPPTGDSEATPVPPTGDSG |
|---|
| Other Names | BAL, bile salt-activated lipase, Bile salt-stimulated lipase, BSDL, BSSLbile salt-dependent lipase, oncofetal isoform, bucelipase, carboxyl ester hydrolase, Carboxyl ester lipase, carboxyl ester lipase (bile salt-stimulated lipase), CEase, CELL, Cholesterol esterase, EC 3.1.1, EC 3.1.1.13, EC 3.1.1.3, FAP, FAPP, fetoacinar pancreatic protein, LIPA, lysophospholipase, pancreatic, MODY8bile-salt-activated lipase, Pancreatic lysophospholipase, Sterol esterase |
|---|
| Gene, Accession # | CEL, Gene ID: 1056 |
|---|
| Catalog # | NBP1-88502 |
|---|
| Price | |
|---|
| Order / More Info | Carboxyl Ester Lipase/CEL Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|