| Edit |   |
|---|
| Antigenic Specificity | Carboxylesterase 3/CES3/Esterase 31 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Carboxylesterase 3/CES3/Esterase 31 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Carboxylesterase 3/CES3/Esterase 31. This antibody reacts with human. The Carboxylesterase 3/CES3/Esterase 31 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | The immunogen for this antibody is Carboxylesterase 3 - middle region. Peptide sequence TPGIIDSHPWPLAQKIANTLACSSSSPAEMVQCLQQKEGEELVLSKKLKN. |
|---|
| Other Names | carboxylesterase 3, carboxylesterase 3 (brain), EC 3.1.1, EC 3.1.1.1, ES31FLJ21736, esterase 31, Liver carboxylesterase 31 homolog |
|---|
| Gene, Accession # | CES3, Gene ID: 23491, Accession: NP_079198, SwissProt: NP_079198 |
|---|
| Catalog # | NBP1-98271-20ul |
|---|
| Price | |
|---|
| Order / More Info | Carboxylesterase 3/CES3/Esterase 31 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|