| 产品详情 |
| Edit |   |
| Antigenic Specificity | COPG |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The COPG Antibody from Novus Biologicals is a rabbit polyclonal antibody to COPG. This antibody reacts with human. The COPG Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human COPG antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MLPSILVLLKRCVMDDDNEVRDRATFYLNVLEQKQKALNAGYILNGLTVSIPGLERALQQYTLEPSEKPFDLKSVPL |
| Other Names | coat protein gamma-cop, coatomer protein complex, subunit gamma, coatomer protein complex, subunit gamma 1, COPG1coatomer subunit gamma, FLJ21068, Gamma-coat protein, gamma-COP |
| Gene, Accession # | COPG1, Gene ID: 22820 |
| Catalog # | NBP2-55178 |
| Price | |
| Order / More Info | COPG Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|