| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | COPS6 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The COPS6 Antibody from Novus Biologicals is a rabbit polyclonal antibody to COPS6. This antibody reacts with human. The COPS6 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human COPS6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: EVPFNHEILREAYALCHCLPVLSTDKFKTDFYDQCNDVGLMAYLGTITKTCNTMNQFVNKFNVLYDRQGIGRRM |
|---|
| Other Names | BMP2B, BMP2B1, BMP4, COP9 constitutive photomorphogenic homolog subunit 6 (Arabidopsis), COP9 signalosome complex subunit 6, CSN6COP9 subunit 6 (MOV34 homolog, 34 kD), H_NH0506M12.12, hVIP, JAB1-containing signalosome subunit 6, MOFC11, MOV34 homolog, MOV34 homolog, 34 kD, MOV34-34KD, SGN6, Signalosome subunit 6, Vpr-interacting protein |
|---|
| Gene, Accession # | COPS6, Gene ID: 10980 |
|---|
| Catalog # | NBP1-91805 |
|---|
| Price | |
|---|
| Order / More Info | COPS6 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 28202082 |
|---|
| 产品资料 |
|
|