| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | FoxM1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. WB reported in scientific literature (PMID: 30089730). For IHC-Paraffin, HIER pH 6 retrieval is recommended. Western Blot verified by a customer review. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The FoxM1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to FoxM1. This antibody reacts with human. The FoxM1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human FoxM1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GIAPLSSAGPGKEEKLLFGEGFSPLLPVQTIKEEEIQPGEEMPHLARPIKVESPPLEEWPSPAPSFKEESSHSWEDSSQSPTPRPKKSYSGL |
|---|
| Other Names | FKHL16trident, forkhead box M1, forkhead box protein M1, Forkhead, drosophila, homolog-like 16, forkhead-like 16, Forkhead-related protein FKHL16, Hepatocyte nuclear factor 3 forkhead homolog 11, HFH11FOXM1B, HFH-11M-phase phosphoprotein 2, HNF-3, HNF-3/fork-head homolog 11, INS-1, MPHOSPH2, MPP-2, MPP2MPM-2 reactive phosphoprotein 2, PIG29, TGT3, Transcription factor Trident, TRIDENT, WIN, Winged-helix factor from INS-1 cells |
|---|
| Gene, Accession # | FOXM1, Gene ID: 2305 |
|---|
| Catalog # | NBP1-84671 |
|---|
| Price | |
|---|
| Order / More Info | FoxM1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 29367668, 30089730 |
|---|
| 产品资料 |
|
|