| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | FoxM1 |
|---|
| Clone | 2H4 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The FoxM1 Antibody (2H4) from Novus Biologicals is a mouse monoclonal antibody to FoxM1. This antibody reacts with human. The FoxM1 Antibody (2H4) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. |
|---|
| Immunogen | FOXM1 (NP_973731, 22 a.a. - 110 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NAPSETSEEEPKRSPAQQESNQAEASKEVAESNSCKFPAGIKIINHPTMPNTQVVAIPNNANIHSIITALTAKGKESGSSGPNKFILIS |
|---|
| Other Names | FKHL16trident, forkhead box M1, forkhead box protein M1, Forkhead, drosophila, homolog-like 16, forkhead-like 16, Forkhead-related protein FKHL16, Hepatocyte nuclear factor 3 forkhead homolog 11, HFH11FOXM1B, HFH-11M-phase phosphoprotein 2, HNF-3, HNF-3/fork-head homolog 11, INS-1, MPHOSPH2, MPP-2, MPP2MPM-2 reactive phosphoprotein 2, PIG29, TGT3, Transcription factor Trident, TRIDENT, WIN, Winged-helix factor from INS-1 cells |
|---|
| Gene, Accession # | FOXM1, Gene ID: 2305, Accession: NP_973731, SwissProt: NP_973731 |
|---|
| Catalog # | H00002305-M05 |
|---|
| Price | |
|---|
| Order / More Info | FoxM1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|